Tag: Modulator

For research use only. We do not sell to patients. γ-L-Glutamyl-L-alanine CAS No. : 5875-41-2 Biological Activity：γ-L-Glutamyl-L-alanine, composed of gamma-glutamate and alanine, is a proteolytic breakdown product of larger proteins. γ-L-Glutamyl-L-alanine is a natural substrate of the γ-Glutamylcyclotransferase. γ-L-Glutamyl-L-alanine is a positive modulator of calcium-sensing receptor (CaR) function[2][3][4]. Research Area：Others Targets：CaSR|Endogenous Metabolite Related Screening Libraries:Bioactive […]

For research use only. We do not sell to patients. PF-4778574 CAS No. : 1219633-99-4 Biological Activity：PF-4778574 is a positive allosteric modulation of AMPA receptor with EC50 of 45 to 919 nM in differenct cells. Research Area：Neurological Disease Targets：iGluR Related Small Molecules:CIQ;Quinolinic acid-d3;1-Aminocyclobutanecarboxylic acid;Glycine-1-13C,15N;ZL006;PYD-106;NMDA-IN-2;JAMI1001A;(S)-Willardiine;Fanapanel;(S)-AMPA;L-Glutamic acid-15N,d5;PDZ1 Domain inhibitor peptide TFA;Ifenprodil tartrate;Rislenemdaz;Coluracetam;Flupirtine-d4 hydrochloride;DL-Phenylalanine-d5 hydrochloride;NMDA;CFM-2;Lanicemine dihydrochloride;L-Phenylalanine-13C9;VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA;L-Glutamic acid […]

For research use only. We do not sell to patients. LY2452473 CAS No. : 1029692-15-6 Biological Activity：LY2452473 is an orally bioavailable, selective androgen receptor modulator (SARM). Research Area：Cancer|Metabolic Disease Targets：Androgen Receptor Related Screening Libraries:Drug Repurposing Compound Library Plus;Clinical Compound Library Plus;Bioactive Compound Library Plus;Anti-Cancer Compound Library;Clinical Compound Library;Drug Repurposing Compound Library;Anti-COVID-19 Compound Library;Orally Active Compound […]

For research use only. We do not sell to patients. CGP7930 CAS No. : 57717-80-3 Biological Activity：CGP7930 (3-(3’,5’-Di-tert-butyl-4’-hydroxy) phenyl-2, 2-dimethylpropanol) is a positive metabotropic GABAB receptor allosteric modulator. CGP7930 enhances the inhibitory effect of l-baclofen on the oscillatory activity of cultured cortical neurons. Research Area：Neurological Disease Targets：GABA Receptor Related Small Molecules:SKF89976A hydrochloride;mGAT-IN-1;Alpidem;FG8119;Valerenic acid;Picrotoxinin;Miltirone;Etifoxine-13C,d3;Adipiplon;Gabazine;Broflanilide;Fluxametamide;ONO-8590580;γ-Aminobutyric acid-d6;Ginsenoside Rc;Fipronil;p-Hydroxybenzaldehyde-13C;Lesogaberan […]

For research use only. We do not sell to patients. BMS-984923 CAS No. : 1375752-78-5 Biological Activity：BMS-984923, a potent mGluR5 silent allosteric modulator (SAM), with exquisite binding affinity (Ki = 0.6 nM), exhibits good oral bioavailability and BBB penetration. BMS-984923 potently inhibits the PrPC-mGluR5 interaction and prevents pathological Aβo signaling without affecting physiological glutamate signaling. […]

For research use only. We do not sell to patients. Zuclomiphene-d4 citrate CAS No. : 2714316-71-7 Biological Activity：Zuclomiphene D4 citrate is a deuterium labeled Zuclomiphene citrate. Zuclomiphene citrate has an antiestrogenic effect and can inhibit the secretion of luteinizing hormone (LH) more than the trans isomer. Zuclomiphene citrate is also an orally active hypocholesterolemic agent[2][3][4]. […]

For research use only. We do not sell to patients. 4-PQBH CAS No. : 2243355-51-1 Biological Activity：4-PQBH is a potent Nur77 binder (KD=1.17 μM). 4-PQBH extensively induces caspase-independent cytoplasmic vacuolization and paraptosis through Nur77-mediated ER stress and autophagy. 4-PQBH can be used for cancer research. Research Area：Cancer Targets：Others Related Small Molecules:Immune initiator-1;Obiltoxaximab;DIBAC-GGFG-NH2CH2-Dxd;Cyanine5.5 maleimide chloride;Cymarin;Z-Glycine;2-Deoxy-2-fluoro-D-glucose-13C,d7;Water-18O;Fmoc-N-Me-D-Ala-OH;3,5-Diiodo-L-tyrosine;N3-Pen-Dde;Zimeldine-d6;Ornidazole diol;Nylidrin […]

For research use only. We do not sell to patients. Chrexanthomycin C Biological Activity：Chrexanthomycin C is an orally active marine natural product with remarkable bioactivities. Chrexanthomycin C has binding affinity for DNA (G4C2)4 G4 with a Kd value of 2.8 mM. Chrexanthomycin C can be used for the research of neurodegenerative disease such as amyotrophic […]

For research use only. We do not sell to patients. 3,5-Diiodothyropropionic acid CAS No. : 1158-10-7 Biological Activity：3,5-Diiodothyropropionic acid is a thyroid hormone analog, induces α-myosin heavy chain mRNA expression, binds to thyroid hormone receptor (TR), with Ka of 2.40 and 4.06 M-1 for TRα1 and TRβ1, respectively. Research Area：Cardiovascular Disease|Endocrinology Targets：Thyroid Hormone Receptor Related […]

For research use only. We do not sell to patients. SU-4942 CAS No. : 76086-99-2 Biological Activity：SU-4942 is a tyrosine kinase signal signal modulator. SU-4942 inhibits VEGF- and endothelial cell growth factor (ECGF)-induced mitogenesis in endothelial cells (US5792783A). Research Area：Cancer Targets：Tyrosinase Related Screening Libraries:Natural Product-like Compound Library;Bioactive Compound Library Plus;Kinase Inhibitor Library;Metabolism/Protease Compound Library;Anti-Cancer Compound […]