Tag: Modulator

For research use only. We do not sell to patients. BIO-32546 CAS No. : 1548743-66-3 Biological Activity：BIO-32546 (example 12b, S-isomer) is an autotaxin (ATX) modulator, extracted from the patent US20170158687A1. Research Area：Cancer Targets：Phosphodiesterase (PDE) Related Small Molecules:Senazodan hydrochloride;(E/Z)-HA155;Enpp/Carbonic anhydrase-IN-1;ATX inhibitor 22;Carbazeran citrate;Bay 60-7550;BC11-38;Deltarasin hydrochloride;Glaucine;Ziritaxestat;Udenafil-d7;D159687;ITI-214;PDE10-IN-5;ICI 153110;Furamidine dihydrochloride;ML-030;PDE4-IN-10;Mirodenafil-d7 dihydrochloride;PDE1-IN-4;PDE4B-IN-3;Cirsimarin;PF-03049423;IBMX;Pimobendan;Gisadenafil besylate;S32826 disodium Trending products：Recombinant Proteins  |  Bioactive Screening […]

For research use only. We do not sell to patients. Desisobutyryl-ciclesonide CAS No. : 161115-59-9 Biological Activity：Desisobutyryl-ciclesonide is the active metabolite of Ciclesonide. Desisobutyryl-ciclesonide has affinity for the glucocorticoid receptor. Research Area：Inflammation/Immunology|Endocrinology Targets：Glucocorticoid Receptor Related Screening Libraries:Bioactive Compound Library Plus;Immunology/Inflammation Compound Library;Endocrinology Compound Library;Targeted Diversity Library;Nuclear Receptor Compound Library; Related Small Molecules:Deflazacort-D5;Glucocorticoid receptor agonist-2;AZD2906;Beclometasone dipropionate;ORIC-101;Clobetasone […]

For research use only. We do not sell to patients. Gastric Inhibitory Polypeptide (1-30), porcine CAS No. : 134875-67-5 Biological Activity：Gastric Inhibitory Polypeptide (1-30), porcine lacks the C-terminal 12 amino acid residues of natural gastric inhibitory polypeptide (GIP), exhibits biologic activity by potentiating the release of insulin and somatostatin. Research Area：Endocrinology Targets：Insulin Receptor Related Small […]

For research use only. We do not sell to patients. GPCR modulator-1 CAS No. : 1407592-99-7 Biological Activity：GPCR modulator-1 is a negative allosteric modulator of GLP receptor. GPCR modulator-1 has the potential for type 2 diabetes research. Research Area：Metabolic Disease Targets：GCGR Related Small Molecules:BETP;GLP-1R agonist 4;VU0453379;PF-06291874;Utreglutide;TT-OAD2;Efocipegtrutide;GLP-1 receptor agonist 2;NNC-0640;Cochinchinenin C;{Val1}-Exendin-3/4;GLP-1(28-36)amide TFA;Exendin-4 acetate;Glepaglutide;GLP-1(7-37);GLP-1 receptor agonist 4;Avexitide;Exendin-3/4 (59-86);FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS;GLP-1R modulator C16;GLP-1(9-36)amide;LSN3318839;GLP-1R agonist 5 […]

For research use only. We do not sell to patients. mGluR2 modulator 2 CAS No. : 1004614-86-1 Biological Activity：mGluR2 modulator 2 (compound 2) is a potent, selective and orally bioavailable mGluR2 positive allosteric modulator with an EC50 value of 0.13 μM. mGluR2 modulator 2 can be used for researching antipsychotic. Research Area：Neurological Disease Targets：mGluR Related […]

For research use only. We do not sell to patients. HBV-IN-18 Biological Activity：HBV-IN-18 (Compound 3) is an HBV capsid assembly modulator (CpAM) with an EC50 of 2790 nM. Research Area：Infection Targets：HBV Related Small Molecules:DVR-01;Bicyclol;Catalpol;Schisantherin C;HBV-IN-20;Glycosmisic acid;Schisanwilsonin C;RO6889678;Thiamine hydrochloride;Evixapodlin;Canocapavir;HBV-IN-19;Bifendate-d6;(5S,8R)-HBV-IN-10;Punicalin;OSS_128167;3′-DMTr-dG(iBu);HBV-IN-8;HBV-IN-7;L-2′-Fd4C;AB-729;Hepatitis B Virus Core (128-140);Besifovir Dipivoxil maleate;AT-130;HBV-IN-4 Trending products：Recombinant Proteins  |  Bioactive Screening Libraries  |  Natural Products  |  […]

For research use only. We do not sell to patients. ML198 CAS No. : 1380716-06-2 Biological Activity：ML198 is a glucocerebrosidase (GCase) modulator with an EC50 of 0.4 μM. ML198 is an activator and non-inhibitory chaperone of glucocerebrosidase. ML198 can be used for the research of Gaucher disease. Research Area：Metabolic Disease Targets：Glucosidase Related Screening Libraries:Bioactive Compound […]

For research use only. We do not sell to patients. Arundic Acid CAS No. : 185517-21-9 Biological Activity：Arundic acid (ONO-2506) is an astrocyte-modulating agent, which delays the expansion of cerebral infarcts by modulating the activation of astrocytes through inhibition of S-100β synthesis. Arundic acid has the potential for stroke and Alzheimer’s disease research[2][3]. Research Area：Neurological […]

For research use only. We do not sell to patients. AP20187 CAS No. : 195514-80-8 Biological Activity：AP20187 (B/B Homodimerizer) is a cell-permeable ligand used to dimerize FK506-binding protein (FKBP) fusion proteins and initiate biological signaling cascades and gene expression or disrupt protein-protein interactions. Research Area：Metabolic Disease Targets：FKBP Related Screening Libraries:Bioactive Compound Library Plus;Peptidomimetic Library; Related […]

For research use only. We do not sell to patients. Cariprazine D8 CAS No. : 1308278-50-3 Biological Activity：Cariprazine D8 (RGH-188 D8) is a deuterium labeled Cariprazine. Cariprazine is a novel antipsychotic drug candidate that exhibits high affinity for the D3 (Ki=0.085 nM) and D2 (Ki=0.49 nM) receptors, and moderate affinity for the 5-HT1A receptor (Ki=2.6 […]