Tag: Antagonist

For research use only. We do not sell to patients. ONO4057 CAS No. : 134578-96-4 Biological Activity：ONO4057 is a Leukotriene B4 receptor antagonist, with an IC50 of 0.7±0.3 μM. Research Area：Inflammation/Immunology Targets：Leukotriene Receptor Related Small Molecules:Pranlukast-d4;Verlukast-d6;Ablukast;CP-96486;MK-886;BIIL-260 hydrochloride;Pranlukast;γ-Linolenic acid ethyl ester;REV 5901;U-75302;RS-601;Tipelukast;LM-1484;RG-12525;Quinotolast sodium;Darbufelone mesylate;Chamazulene;11-​Keto-​beta-​boswellic acid;AS-35;Fiboflapon;BAY-u 9773;CP-96021 hydrochloride;Leukotriene B4;Amelubant Trending products：Recombinant Proteins  |  Bioactive Screening Libraries  |  […]

For research use only. We do not sell to patients. Canrenone-d4 Biological Activity：Canrenone-d4 is deuterium labeled Canrenone. Canrenone (Aldadiene) is an aldosterone antagonist extensively used as a diuretic agent. Research Area：Cardiovascular Disease Targets：Mineralocorticoid Receptor|Endogenous Metabolite Related Small Molecules:D-α-Hydroxyglutaric acid disodium;Nicotinamide N-oxide;3-Hydroxyglutaric acid-d5;DPPC-d62;SDMA-d6;2-Mercaptobenzothiazole;N-Acetyl-L-glutamic acid-d5;(3R,5S)-3-Hydroxy Cotinine-d3;Biliverdin hydrochloride;D-Glucose-13C,d1-3;2,3-Diaminopropionic acid hydrochloride;Docosanoic acid-d3;Choline-d6 chloride;Pregnenolone monosulfate sodium;25-Hydroxycholesterol-d6;Pyrroloquinoline quinone;Roridin L2;NAPQI;Imidazole;Adipokinetic hormone I […]

For research use only. We do not sell to patients. INCB3344 CAS No. : 1262238-11-8 Biological Activity：INCB3344 is a potent, selective and orally bioavailable CCR2 antagonist with IC50 values of 5.1 nM (hCCR2) and 9.5 nM (mCCR2) in binding antagonism and 3.8 nM (hCCR2) and 7.8 nM (mCCR2) in antagonism of chemotaxis activity. Research Area：Inflammation/Immunology|Endocrinology […]

For research use only. We do not sell to patients. (R)-Terazosin CAS No. : 109351-34-0 Biological Activity：(R)-Terazosin is an active R-enantiomer of Terazosin. (R)-Terazosin is a potent α1-adrenoceptor antagonist with Ki values of 6.51 nM, 1.01 nM and 1.97 nM for α1a, α1b and α1d-adrenoceptor, respectively. Research Area：Endocrinology Targets：Adrenergic Receptor Related Screening Libraries:Covalent Screening Library […]

For research use only. We do not sell to patients. Asenapine-13C,d3 hydrochloride Biological Activity：Asenapine-13C,d3 (hydrochloride) is the 13C- and deuterium labeled Asenapine (hydrochloride). Asenapine hydrochloride, an antipsychotic, is a 5-HT (1A, 1B, 2A, 2B, 2C, 5A, 6, 7) and Dopamine (D2, D3, D4) receptor antagonist with Ki values of 0.03-4.0 nM for 5-HT and 1.3, […]

For research use only. We do not sell to patients. Hydroxyzine D4 CAS No. : 2070014-84-3 Biological Activity：Hydroxyzine D4 is deuterium labeled Hydroxyzine. Hydroxyzine is a heterocyclic histamine H1-receptor antagonist. Hydroxyzine has anticholinergic, anxiolytic and analgesic properties. Research Area：Endocrinology|Inflammation/Immunology|Neurological Disease Targets：Histamine Receptor Related Small Molecules:Tripelennamine;Brompheniramine-d6 maleate;Samelisant;Chlorphenoxamine;H3 receptor-MO-1;Diphenhydramine;ABT-239;Ketotifen fumarate;Ranitidine;Cetirizine;Diphenylpyraline hydrochloride;Loratadine-d5;Phenyltoloxamine;Ritanserin;BMY-25271;FRG8701;Mecamylamine hydrochloride;Cimetidine sulfoxide;Brompheniramine maleate;Tecastemizole;Famotidine-13C,d3;Bromazine-d6 hydrochloride Trending products：Recombinant […]

For research use only. We do not sell to patients. MK-1064 CAS No. : 1207253-08-4 Biological Activity：MK-1064 is a selective and orally active OX2R antagonist (Ki: 0.5 nM, IC50: 18 nM). MK-1064 promotes sleep in vivo. MK-1064 can be used in the research of insomnia[3]. Research Area：Cancer|Endocrinology Targets：Orexin Receptor (OX Receptor) Related Screening Libraries:Clinical Compound […]

For research use only. We do not sell to patients. PNU 37883 hydrochloride CAS No. : 57568-80-6 Biological Activity：PNU 37883 hydrochloride (PNU 37883A) is a selective vascular ATP-sensitive potassium (Kir6, KATP) channels blocker. PNU 37883 hydrochloride has diuretic effects with specific binding in kidney and vascular smooth muscle rather than in brain or pancreatic beta […]

For research use only. We do not sell to patients. Procyclidine-d11 hydrochloride Biological Activity：Procyclidine-d11 hydrochloride is the deuterium labeled Procyclidine hydrochloride. Procyclidine hydrochloride is a potent anti-cholinergic agent, and is also known to have NMDA antagonist properties. Research Area：Neurological Disease Targets：iGluR Related Small Molecules:CIQ;Quinolinic acid-d3;1-Aminocyclobutanecarboxylic acid;Glycine-1-13C,15N;ZL006;PYD-106;NMDA-IN-2;JAMI1001A;(S)-Willardiine;Fanapanel;(S)-AMPA;L-Glutamic acid-15N,d5;PDZ1 Domain inhibitor peptide TFA;Ifenprodil tartrate;Rislenemdaz;Coluracetam;Flupirtine-d4 hydrochloride;DL-Phenylalanine-d5 hydrochloride;NMDA;CFM-2;Lanicemine dihydrochloride;L-Phenylalanine-13C9;VSGLNPSLWSIFGLQFILLWLVSGSRHYLW […]

For research use only. We do not sell to patients. AS2717638 CAS No. : 2148339-28-8 Biological Activity：AS2717638 is an oral active and selective lysophosphatidic acid receptor 5 (LPA5) antagonist, with an IC50 of 38 nM for hLPA5. AS2717638 also significantly improves PGE2-, PGF2α-, and AMPA-induced allodynia. Research Area：Inflammation/Immunology Targets：LPL Receptor Related Screening Libraries:Bioactive Compound Library […]