Tag: Antagonist

For research use only. We do not sell to patients. Phentolamine CAS No. : 50-60-2 Biological Activity：Phentolamine is a potent, selective and orally active α1 adrenergic and α2 adrenergic receptor antagonist. Phentolamine can be used for the treatment of erectile dysfunction[2][3]. Research Area：Endocrinology Targets：Adrenergic Receptor Related Small Molecules:Todralazine;ARC 239 dihydrochloride;Yohimbine;Glaucine;Salbutamol;BI-167107;Talibegron hydrochloride;Arotinolol;SR59230A;Higenamine hydrochloride;Navafenterol saccharinate;Isoprenaline hydrochloride;Bevantolol;Zilpaterol-d7;Ritanserin;A55453;Povafonidine;β3-AR agonist […]

For research use only. We do not sell to patients. PSB36 CAS No. : 524944-72-7 Biological Activity：PSB36 is a potent and selective antagonist of adenosine A1 receptor, with Kis 0.12 nM, 187 nM, 552 nM, 2300 nM, and 6500 nM for rA1, hA2B, rA2A, hA3 and rA3 receptors respectively. PSB36 can be used for the […]

For research use only. We do not sell to patients. Sulfinalol CAS No. : 66264-77-5 Biological Activity：Sulfinalol is an orally active β-adrenoceptor antagonist with direct vasodilator activity. Research Area：Cardiovascular Disease Targets：Adrenergic Receptor Related Small Molecules:Todralazine;ARC 239 dihydrochloride;Yohimbine;Glaucine;Salbutamol;BI-167107;Talibegron hydrochloride;Arotinolol;SR59230A;Higenamine hydrochloride;Navafenterol saccharinate;Isoprenaline hydrochloride;Bevantolol;Zilpaterol-d7;Ritanserin;A55453;Povafonidine;β3-AR agonist 1;Tulobuterol;AGN 192836;KUC-7322;Oxyfedrine;Urapidil hydrochloride;Detomidine hydrochloride;Oxprenolol-d7 hydrochloride;Nicergoline;Synephrine hemitartrate;ADRA1D receptor antagonist 1;Solabegron Trending products：Recombinant Proteins  |  […]

For research use only. We do not sell to patients. L-701252 CAS No. : 151057-13-5 Biological Activity：L-701252 is a potent antagonist of glycine site NMDA receptor with an IC50 of 420 nM. L-701252 provides a small degree of neuroprotection in global cerebral ischaemia. Research Area：Neurological Disease Targets：iGluR Related Screening Libraries:Bioactive Compound Library Plus;Membrane Transporter/Ion Channel […]

For research use only. We do not sell to patients. Phenindione CAS No. : 83-12-5 Biological Activity：Phenindione is an anticoagulant which functions as a Vitamin K antagonist. Target: Others Phenindione(Rectadione) is an anticoagulant which functions as a Vitamin K antagonist. A lymphocyte transformation test showed proliferation of T-cells from the hypersensitive patient, but not from […]

For research use only. We do not sell to patients. Solifenacin-d7 hydrochloride Biological Activity：Solifenacin-d7 hydrochloride is the deuterium labeled Solifenacin hydrochloride. Solifenacin hydrochloride (YM905 hydrochloride) is a muscarinic receptor antagonist, with pKis of 7.6, 6.9 and 8.0 for M1, M2 and M3 receptors, respectively. Research Area：Neurological Disease Targets：mAChR Related Small Molecules:VU0357017 hydrochloride;TBPB;Imidafenacin;Sabcomeline;MK-6884;Brompheniramine-d6 maleate;Navafenterol saccharinate;DREADD agonist […]

For research use only. We do not sell to patients. Maceneolignan H CAS No. : 1314042-85-7 Biological Activity：Maceneolignan H (Compound 8) is a neolignane compound isolated from the arils of Myristica fragrans. Maceneolignan H is a selective CCR3 antagonist (EC50 = 1.4 μM). Maceneolignan H has the potential for the research of allergic diseases. Research […]

For research use only. We do not sell to patients. Ipratropium bromide hydrate CAS No. : 66985-17-9 Biological Activity：Ipratropium bromide (Sch 1000) hydrate is a muscarinic receptor antagonist, with IC50s of 2.9 nM, 2 nM, and 1.7 nM for M1, M2, and M3 receptors, respectively. Ipratropium bromide hydrate relaxes smooth muscle, can be used in […]

For research use only. We do not sell to patients. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW CAS No. : 2279952-25-7 Biological Activity：VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 – NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain. Research Area：Neurological […]

For research use only. We do not sell to patients. GnRH-R antagonist 1 Biological Activity：GnRH-R antagonist 1 (compound 21a) is an orally safe and membrane-permeable GnRH-R antagonist with high binding affinity (IC50=0.57 nM) and potent in vitro antagonistic activity (IC50=2.18 nM). GnRH-R antagonist 1 can be used in studies of advanced prostate cancer and premature […]