Tag: Antagonist

For research use only. We do not sell to patients. Zonampanel CAS No. : 210245-80-0 Biological Activity：Zonampanel (YM 872) is a selective antagonist of the glutamate receptor subtype, α-amino-3-hydroxy-5-methylisoxazole-4-propionic acid (AMPA) receptor. Research Area：Metabolic Disease Targets：iGluR Related Screening Libraries:Drug Repurposing Compound Library Plus;Clinical Compound Library Plus;Bioactive Compound Library Plus;Membrane Transporter/Ion Channel Compound Library;Neuronal Signaling Compound […]

For research use only. We do not sell to patients. TDN345 CAS No. : 134069-68-4 Biological Activity：TDN345 is a Ca2+ antagonist, used for the treatment of vascular and senile dementia including Alzheimer’s disease. Research Area：Neurological Disease Targets：Calcium Channel Related Small Molecules:Benidipine hydrochloride;CaV1.3 antagonist-1;14-Deoxyandrographolide;(Rac)-MEM 1003;Glaucine;Efonidipine hydrochloride monoethanolate;L-Ascorbic acid sodium salt;Brompheniramine-d6 maleate;MRS 1523;Nilvadipine;Lercanidipine;CP-060;Anipamil-d25 hydrochloride;ISX-9;ω-Conotoxin MVIIC;Catharanthine;Thapsigargin;Tetrandrine;Ginsenoside Rd;Manidipine dihydrochloride;ω-Agatoxin […]

For research use only. We do not sell to patients. CV-159 CAS No. : 86384-98-7 Biological Activity：CV-159 is a unique dihydropyridine Ca2+ antagonist with an anti-calmodulin (CaM) action, and has antiinflammatory activities. Research Area：Inflammation/Immunology Targets：Calmodulin Related Small Molecules:Psoralenoside;CALP1;W-7 hydrochloride;Calmodulin antagonist-1;Calmodulin Binding Peptide 1;Acremonidin A;CALP2;Neurogranin (48-76), mouse;Stains-All;Metofenazate;Acremoxanthone C Trending products：Recombinant Proteins  |  Bioactive Screening Libraries  |  […]

For research use only. We do not sell to patients. Tipelukast CAS No. : 125961-82-2 Biological Activity：Tipelukast (KCA 757) is a sulfidopeptide leukotriene receptor antagonist, an orally bioavailable anti-inflammatory agent and used for the treatment of asthma. Research Area：Inflammation/Immunology Targets：Leukotriene Receptor Related Small Molecules:Pranlukast-d4;Verlukast-d6;Ablukast;CP-96486;MK-886;BIIL-260 hydrochloride;Pranlukast;γ-Linolenic acid ethyl ester;REV 5901;U-75302;RS-601;LM-1484;RG-12525;Quinotolast sodium;Darbufelone mesylate;Chamazulene;11-​Keto-​beta-​boswellic acid;AS-35;Fiboflapon;BAY-u 9773;ONO4057;CP-96021 hydrochloride;Leukotriene B4;Amelubant […]

For research use only. We do not sell to patients. Becampanel CAS No. : 188696-80-2 Biological Activity：Becampanel (AMP397) is the first competitive AMPA antagonist and an antiepileptic agent. Research Area：Neurological Disease Targets：iGluR Related Small Molecules:CIQ;Quinolinic acid-d3;1-Aminocyclobutanecarboxylic acid;Glycine-1-13C,15N;ZL006;PYD-106;NMDA-IN-2;JAMI1001A;(S)-Willardiine;Fanapanel;(S)-AMPA;L-Glutamic acid-15N,d5;PDZ1 Domain inhibitor peptide TFA;Ifenprodil tartrate;Rislenemdaz;Coluracetam;Flupirtine-d4 hydrochloride;DL-Phenylalanine-d5 hydrochloride;NMDA;CFM-2;Lanicemine dihydrochloride;L-Phenylalanine-13C9;VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA;L-Glutamic acid monosodium salt;Glycine-15N;Ibotenic acid;GYKI-47261 dihydrochloride;Sunifiram Trending products：Recombinant Proteins  […]

For research use only. We do not sell to patients. ZD-1611 CAS No. : 186497-38-1 Biological Activity：ZD-1611 is a potent, orally active, selective ETA receptor antagonist, used for the research of ischemic stroke. Research Area：Cardiovascular Disease|Endocrinology Targets：Endothelin Receptor Related Small Molecules:BQ-788;[Asn18] Endothelin-1, human;Endothelin-3, human, mouse, rabbit, rat TFA;IRL 2500;Sarafotoxin S6c;Sarafotoxin S6a;ANP (1-30), frog;IRL-1620 TFA;Tezosentan;ACT-373898;Ro 46-2005;Ro […]

For research use only. We do not sell to patients. LM-1484 CAS No. : 197506-02-8 Biological Activity：LM-1484 is an antagonist of CysLT1 receptor and displays a higher affinity for 3H-LTC4 sites. Research Area：Inflammation/Immunology Targets：Leukotriene Receptor Related Small Molecules:Pranlukast-d4;Verlukast-d6;Ablukast;CP-96486;MK-886;BIIL-260 hydrochloride;Pranlukast;γ-Linolenic acid ethyl ester;REV 5901;U-75302;RS-601;Tipelukast;RG-12525;Quinotolast sodium;Darbufelone mesylate;Chamazulene;11-​Keto-​beta-​boswellic acid;AS-35;Fiboflapon;BAY-u 9773;ONO4057;CP-96021 hydrochloride;Leukotriene B4;Amelubant Trending products：Recombinant Proteins  |  Bioactive Screening […]

For research use only. We do not sell to patients. DMP 696 CAS No. : 202578-52-7 Biological Activity：DMP 696 is a selective corticotropin-releasing hormone receptor 1 (CRHR1) antagonist, used for the treatment of anxiety and depression. Research Area：Endocrinology|Neurological Disease Targets：Others Related Screening Libraries:Bioactive Compound Library Plus;Endocrinology Compound Library;Human Metabolite Library; Related Small Molecules:Immune initiator-1;Obiltoxaximab;DIBAC-GGFG-NH2CH2-Dxd;Cyanine5.5 maleimide […]

For research use only. We do not sell to patients. AMG-009 CAS No. : 1027847-67-1 Biological Activity：AMG-009 is a potent antagonist of prostaglandin D2, with IC50 of 3 nM and 12 nM for CRTH2 and DP receptors, respectively. Research Area：Inflammation/Immunology|Endocrinology Targets：Prostaglandin Receptor Related Small Molecules:Omidenepag isopropyl;DG-041;8-Isoprostaglandin E2;BAY-6672;trans-Isoferulic acid;GSK-269984A;KMN-80;SC 51089;p-Hydroxycinnamic acid;Pexopiprant;Dinoprost;Sulprostone;Prostaglandin E2;CAY10471 Racemate;Fevipiprant;TG6-10-1;Cicaprost;ER-819762;MRE-269-d6;ONO-8130;KAG-308;KF 13218;Prostaglandin E2-d4 Trending […]

For research use only. We do not sell to patients. L162389 CAS No. : 169281-53-2 Biological Activity：L162389 is a potent antagonist of angiotensin AT1 receptor with Ki of 28 nM. Research Area：Cardiovascular Disease Targets：Angiotensin Receptor Related Small Molecules:Saralasin;A81988;EMD 66684;TD-0212;Angiotensin I/II (1-6) (TFA);YS-49;TRV055;TRV056;H-Val-Pro-Pro-OH TFA;Tranilast sodium;Angiotensin amide;L-159282;CGP48369;Elisartan;Pratosartan;TRV-120027 TFA;SL910102 Trending products：Recombinant Proteins  |  Bioactive Screening Libraries  |  Natural […]