Tag: Antagonist

For research use only. We do not sell to patients. ZD-9379 CAS No. : 170142-20-8 Biological Activity：ZD-9379 is a potent, orally active, and brain penetrant full antagonist at the glycine site of the NMDA receptor. ZD-9379 has neuroprotective effect[2]. Research Area：Neurological Disease Targets：iGluR Related Small Molecules:CIQ;Quinolinic acid-d3;1-Aminocyclobutanecarboxylic acid;Glycine-1-13C,15N;ZL006;PYD-106;NMDA-IN-2;JAMI1001A;(S)-Willardiine;Fanapanel;(S)-AMPA;L-Glutamic acid-15N,d5;PDZ1 Domain inhibitor peptide TFA;Ifenprodil tartrate;Rislenemdaz;Coluracetam;Flupirtine-d4 hydrochloride;DL-Phenylalanine-d5 […]

For research use only. We do not sell to patients. NAS-181 dimesylate CAS No. : 1217474-40-2 Biological Activity：NAS181 is a potent and selective antagonist of rat 5-HT1B receptor, with a Ki of 47 nM. NAS181 shows 13-fold selectivity for r5-HT1B over bovine 5-HT1B receptor (Ki=630 nM). NAS181 increases the 5-HT turnover and the synaptic concentration […]

For research use only. We do not sell to patients. PPPA CAS No. : 113190-92-4 Biological Activity：PPPA is a competitive NMDA receptor antagonist that displays moderate selectivity for NR2A-containing receptors[2]. Research Area：Neurological Disease Targets：iGluR Related Small Molecules:CIQ;Quinolinic acid-d3;1-Aminocyclobutanecarboxylic acid;Glycine-1-13C,15N;ZL006;PYD-106;NMDA-IN-2;JAMI1001A;(S)-Willardiine;Fanapanel;(S)-AMPA;L-Glutamic acid-15N,d5;PDZ1 Domain inhibitor peptide TFA;Ifenprodil tartrate;Rislenemdaz;Coluracetam;Flupirtine-d4 hydrochloride;DL-Phenylalanine-d5 hydrochloride;NMDA;CFM-2;Lanicemine dihydrochloride;L-Phenylalanine-13C9;VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA;L-Glutamic acid monosodium salt;Glycine-15N;Ibotenic acid;GYKI-47261 dihydrochloride;Sunifiram Trending […]

For research use only. We do not sell to patients. S961 TFA Biological Activity：S961 TFA is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively. Research Area：Metabolic Disease Targets：Insulin Receptor Related Small Molecules:AGL-2263;KU14R;SU4984;HNMPA-(AM)3;OI338;Gastric Inhibitory […]

For research use only. We do not sell to patients. Azilsartan medoxomil monopotassium CAS No. : 863031-24-7 Biological Activity：Azilsartan medoxomil monopotassium is an orally administered angiotensin II receptor type 1 antagonist with IC50 of 0.62 nM, which used in the treatment of adults with essential hypertension. IC50 Value: 0.62 nM [2] Target: AT1 receptor in […]

For research use only. We do not sell to patients. NBQX disodium CAS No. : 479347-86-9 Biological Activity：NBQX disodium (FG9202 disodium) is a highly selective and competitive AMPA receptor antagonist. NBQX disodium has neuroprotective and anticonvulsant activity. Research Area：Neurological Disease Targets：iGluR Related Small Molecules:CIQ;Quinolinic acid-d3;1-Aminocyclobutanecarboxylic acid;Glycine-1-13C,15N;ZL006;PYD-106;NMDA-IN-2;JAMI1001A;(S)-Willardiine;Fanapanel;(S)-AMPA;L-Glutamic acid-15N,d5;PDZ1 Domain inhibitor peptide TFA;Ifenprodil tartrate;Rislenemdaz;Coluracetam;Flupirtine-d4 hydrochloride;DL-Phenylalanine-d5 hydrochloride;NMDA;CFM-2;Lanicemine dihydrochloride;L-Phenylalanine-13C9;VSGLNPSLWSIFGLQFILLWLVSGSRHYLW […]

For research use only. We do not sell to patients. AGN 193109 CAS No. : 171746-21-7 Biological Activity：AGN 193109 is a retinoid analog, and acts as a specific and highly effective antagonist of retinoic acid receptors (RARs), with Kds of 2 nM, 2 nM, and 3 nM for RARα, RARβ, and RARγ, respectively. Research Area：Cancer […]

For research use only. We do not sell to patients. Dehydro Olmesartan CAS No. : 172875-98-8 Biological Activity：Dehydro Olmesartan is a derivative of Olmesartan. Olmesartan is an angiotensin II receptor (AT1R) antagonist and has the potential for high blood pressure study[2]. Research Area：Cardiovascular Disease Targets：Angiotensin Receptor Related Small Molecules:Saralasin;A81988;EMD 66684;TD-0212;Angiotensin I/II (1-6) (TFA);YS-49;TRV055;TRV056;H-Val-Pro-Pro-OH TFA;Tranilast sodium;Angiotensin […]

For research use only. We do not sell to patients. (Rac)-5-Hydroxymethyl Tolterodine CAS No. : 200801-70-3 Biological Activity：(Rac)-5-Hydroxymethyl Tolterodine ((Rac)-Desfesoterodine), an active metabolite of Tolterodine, is a mAChR antagonist (Ki values of 2.3 nM, 2 nM, 2.5 nM, 2.8 nM, and 2.9 nM for M1, M2, M3, M4, and M5 receptors, respectively). (Rac)-5-Hydroxymethyl Tolterodine can […]

For research use only. We do not sell to patients. AUNP-12 CAS No. : 1353563-85-5 Biological Activity：AUNP-12 (NP-12) is a peptide antagonist of the PD-1 signaling pathway, displays equipotent antagonism toward PD-L1 and PD-L2 in rescue of lymphocyte proliferation and effector functions. AUNP-12 exhibits immune activation, excellent antitumor activity, and potential for better management of […]