Tag: Antagonist

For research use only. We do not sell to patients. Mosapramine CAS No. : 89419-40-9 Biological Activity：Mosapramine (Clospipramine) is an orally active and potent dopamine receptor antagonist with high affinity to dopamine receptor subtypes 2, 3 and 4, and with moderate affinity for the 5-HT2 receptor. Mosapramine shows antipsychotic activity and can be used in […]

For research use only. We do not sell to patients. PD 102807 CAS No. : 23062-91-1 Biological Activity：PD 102807 is a M4 muscarinic receptor antagonist with an IC50 of 90.7 nM. PD 102807 inhibits M1, M2, M3, M5 muscarinic receptor with IC50s of 6558.7, 3440.7, 950.0, and 7411.7 nM, respectively. Antidyskinetic effect. Research Area：Neurological Disease […]

For research use only. We do not sell to patients. Bupranolol-d9 CAS No. : 2468771-00-6 Biological Activity：Bupranolol-d9 is the deuterium labeled Bupranolol. Bupranolol is an orally active, competitive and non-selective β-adrenoceptor antagonist without intrinsic sympathomimetic activity. Research Area：Cancer|Inflammation/Immunology Targets：Adrenergic Receptor Related Small Molecules:Todralazine;ARC 239 dihydrochloride;Yohimbine;Glaucine;Salbutamol;BI-167107;Talibegron hydrochloride;Arotinolol;SR59230A;Higenamine hydrochloride;Navafenterol saccharinate;Isoprenaline hydrochloride;Bevantolol;Zilpaterol-d7;Ritanserin;A55453;Povafonidine;β3-AR agonist 1;Tulobuterol;AGN 192836;KUC-7322;Oxyfedrine;Urapidil hydrochloride;Detomidine hydrochloride;Oxprenolol-d7 hydrochloride;Nicergoline;Synephrine […]

For research use only. We do not sell to patients. NBI-74330 CAS No. : 855527-92-3 Biological Activity：NBI-74330 is a potent antagonist for CXCR3, and exhibits potent inhibition of (125I)CXCL10 and (125I)CXCL11 specific binding with Ki of 1.5 and 3.2 nM, respectively. Research Area：Inflammation/Immunology|Endocrinology Targets：CXCR Related Screening Libraries:Bioactive Compound Library Plus;GPCR/G Protein Compound Library;Immunology/Inflammation Compound Library;Small […]

For research use only. We do not sell to patients. ER 50891 CAS No. : 187400-85-7 Biological Activity：ER-50891 is a potent antagonist of retinoic acid receptor α(RARα). ER-50891 significantly attenuates ATRA’s inhibitive effects on BMP 2-induced osteoblastogenesis. Research Area：Cancer Targets：RAR/RXR Related Small Molecules:AGN 193109-d7;Retinoic acid;AC-261066;Magnolol;(+)-Talarozole;Trifarotene;β-Apo-13-carotenone;Bigelovin;CD2665;BMS453;9-cis-Retinoic acid;AGN-195183;Fenretinide;Liarozole dihydrochloride;BMS-195614;LE135;Tamibarotene;UVI 3003;PROTAC RAR Degrader-1;BMS641;Tarenflurbil Trending products：Recombinant Proteins  |  Bioactive […]

For research use only. We do not sell to patients. Epinastine hydrochloride CAS No. : 108929-04-0 Biological Activity：Epinastine hydrochloride (WAL801 hydrochloride) is an antihistamine and mast cell stabilizer. Epinastine hydrochloride is a potent, selective and orally-active histamine H1 receptor antagonist. Epinastine hydrochloride also inhibits IL-8 release and has an antiallergic action[2][3]. Research Area：Endocrinology|Inflammation/Immunology Targets：Histamine Receptor […]

For research use only. We do not sell to patients. L-Phenylalanine-13C9 CAS No. : 439685-11-7 Biological Activity：L-Phenylalanine-13C9 ((S)-2-Amino-3-phenylpropionic acid-13C9) is the 13C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive […]

For research use only. We do not sell to patients. Mozavaptan hydrochloride CAS No. : 138470-70-9 Biological Activity：Mozavaptan hydrochloride (OPC-31260 hydrochloride) is a benzazepine derivative and a potent, selective, competitive and orally active vasopressin V2 receptor antagonist with an IC50 of 14 nM. Mozavaptan hydrochloride shows ~85-fold selectivity for V2 receptor over V1 receptor (IC50 […]

For research use only. We do not sell to patients. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA Biological Activity：VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 – NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain. Research Area：Neurological Disease Targets：Others|iGluR […]

For research use only. We do not sell to patients. GLPG1205 CAS No. : 1445847-37-9 Biological Activity：GLPG1205 is potent, selective and orally active GPR84 (a G-protein-coupled receptor) antagonist with a favorable PK/PD profile. GLPG1205 has anti-inflammatory activity and is used for the treatment of pulmonary fibrosis[2]. Research Area：Inflammation/Immunology Targets：GPR84 Related Screening Libraries:Drug Repurposing Compound Library […]