Fasidotril

For research use only. We do not sell to patients.

Fasidotril

CAS No. : 135038-57-2

Biological Activity:Fasidotril is a dual inhibitor of neprilysin and angiotensin-converting enzyme (ACE) for the potential treatment of hypertension and congestive heart failure (CHF).

Research Area:Cardiovascular Disease

Targets:Angiotensin-converting Enzyme (ACE)

Related Small Molecules:Imidaprilate-d5;Mca-Ala-Pro-Lys(Dnp)-OH;Abz-FR-K(Dnp)-P-OH;H-Tyr-Tyr-OH;Deserpidine;BMS-265246;Vicenin 3;Delapril hydrochloride;Vicenin 2;Cilazapril;Phosphoramidon Disodium;N-Acetyl-Ser-Asp-Lys-Pro TFA;AD012;STIEEQAKTFLDKFNHEAEDLFYQSSLASWN;NCX899;Utibapril;Pivalopril;Rentiapril racemate;(R)-MLN-4760;AD013

Trending products:Recombinant Proteins  |  Bioactive Screening Libraries  |  Natural Products  |  Fluorescent Dye  |  PROTAC  |  Isotope-Labeled Compounds  |  Oligonucleotides

About Us:

  • MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use;
  • Structurally and synthetically diverse biologically active compounds;
  •  roduct quality is the key to our success and we take pride in offering only the highest-grade products.;
  • We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.;
  • Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.;
  • Structurally and synthetically diverse biologically active compounds;

  • Customized order volume ranging from milligrams to kilograms scale;
  • We provide customer-oriented services. To explore more, please contact us at [email protected]. Our team will gladly assist you.

50K Diversity Library
Top Publications Citing Use of MCE Products
Recombinant Proteins
magnetic-beads