(S)-(-)-5-Fluorowillardiine hydrochloride

For research use only. We do not sell to patients.

(S)-(-)-5-Fluorowillardiine hydrochloride

CAS No. : 1321546-70-6

Biological Activity:(S)-(-)-5-Fluorowillardiine hydrochloride is a potent and specific AMPAR agonist.

Research Area:Neurological Disease

Targets:iGluR

Related Screening Libraries:Bioactive Compound Library Plus;Membrane Transporter/Ion Channel Compound Library;Neuronal Signaling Compound Library;Neurotransmitter Receptor Compound Library;

Related Small Molecules:CIQ;Quinolinic acid-d3;1-Aminocyclobutanecarboxylic acid;Glycine-1-13C,15N;ZL006;PYD-106;NMDA-IN-2;JAMI1001A;(S)-Willardiine;Fanapanel;(S)-AMPA;L-Glutamic acid-15N,d5;PDZ1 Domain inhibitor peptide TFA;Ifenprodil tartrate;Rislenemdaz;Coluracetam;Flupirtine-d4 hydrochloride;DL-Phenylalanine-d5 hydrochloride;NMDA;CFM-2;Lanicemine dihydrochloride;L-Phenylalanine-13C9;VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA;L-Glutamic acid monosodium salt;Glycine-15N;Ibotenic acid;GYKI-47261 dihydrochloride;Sunifiram

Trending products:Recombinant Proteins  |  Bioactive Screening Libraries  |  Natural Products  |  Fluorescent Dye  |  PROTAC  |  Isotope-Labeled Compounds  |  Oligonucleotides

About Us:

  • MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use;
  • Structurally and synthetically diverse biologically active compounds;
  •  roduct quality is the key to our success and we take pride in offering only the highest-grade products.;
  • We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.;
  • Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.;
  • Structurally and synthetically diverse biologically active compounds;

  • Customized order volume ranging from milligrams to kilograms scale;
  • We provide customer-oriented services. To explore more, please contact us at [email protected] Our team will gladly assist you.

50K Diversity Library
Top Publications Citing Use of MCE Products
Recombinant Proteins
magnetic-beads