IL6ST (Human) Recombinant Protein (Q01)

Name :
IL6ST (Human) Recombinant Protein (Q01)

Biological Activity :
Human IL6ST partial ORF ( NP_002175, 23 a.a. – 122 a.a.) recombinant protein with GST-tag at N-terminal.

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_002175

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3572

Amino Acid Sequence :
ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS

Molecular Weight :
36.74

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (68); Rat (73)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
IL6ST

Gene Alias :
CD130, CDw130, GP130, GP130-RAPS, IL6R-beta

Gene Description :
interleukin 6 signal transducer (gp130, oncostatin M receptor)

Gene Summary :
The protein encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggested a critical role of the gene encoding this protein in regulating myocyte apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq

Other Designations :
CD130 antigen|IL6ST nirs variant 3|OTTHUMP00000122545|gp130 of the rheumatoid arthritis antigenic peptide-bearing soluble form|gp130 transducer chain|interleukin 6 signal transducer|interleukin receptor beta chain|membrane glycoprotein gp130|oncostatin M

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SHH Proteincustom synthesis
SCF ProteinMedChemExpress
Popular categories:
Angiopoietin-Like 8
4-1BBL/CD137L

haoyuan2014