Name :
CD72 (Human) Recombinant Protein
Biological Activity :
Human CD72 (P21854, 1 a.a. – 98 a.a.) partial recombinant protein expressed in Escherichia coli.
Tag :
Protein Accession No. :
P21854
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=971
Amino Acid Sequence :
MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLL
Molecular Weight :
38
Storage and Stability :
Store at -20°C to -80°C for 12 week.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
In 50mM Tris-HCl pH 7.5 (10 mM L-glutathione (reduced))
Applications :
SDS-PAGE，
Gene Name :
CD72
Gene Alias :
CD72b, LYB2
Gene Description :
CD72 molecule
Gene Summary :
Other Designations :
CD72 antigen|OTTHUMP00000021342|OTTHUMP00000045360
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
B7-H3 web
CD19 web
Popular categories:
CCL21
Breast Tumor Kinase