IL6R (Human) Recombinant Protein

Name :
IL6R (Human) Recombinant Protein

Biological Activity :
Human IL6R (P08887, 20 a.a. – 365 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :
Result of bioactivity analysis

Protein Accession No. :
P08887

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3570

Amino Acid Sequence :
LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP

Molecular Weight :
39.6

Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Viruses

Interspecies Antigen Sequence :

Preparation Method :
Baculovirus expression system

Purification :

Quality Control Testing :
3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

Storage Buffer :
In Phosphate-Buffer Saline pH 7.4 (10% glycerol)

Applications :
Functional Study, SDS-PAGE,

Gene Name :
IL6R

Gene Alias :
CD126, IL-6R-1, IL-6R-alpha, IL6RA, MGC104991

Gene Description :
interleukin 6 receptor

Gene Summary :
Interleukin 6 (IL6) is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in immune response. The protein encoded by this gene is a subunit of the receptor complex for IL6. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq

Other Designations :
CD126 antigen|OTTHUMP00000034320|interleukin 6 receptor alpha subunit

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
B7-1/CD80 web
TIM-3 Recombinant Proteins
Popular categories:
CD40
Contactin-3

haoyuan2014