ZFAND5 (Human) Recombinant Protein

Name :
ZFAND5 (Human) Recombinant Protein

Biological Activity :
Human ZFAND5 (NP_005998, 1 a.a. – 213 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :

Protein Accession No. :
O76080

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=7763

Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSMAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI

Molecular Weight :
25.5

Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :
3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. SDS-PAGE analysis of ZFAND5 (Human) Recombinant Protein

Storage Buffer :
In PBS, pH 7.4 (1 mM DTT, 30% glycerol).

Applications :
SDS-PAGE,

Gene Name :
ZFAND5

Gene Alias :
ZA20D2, ZFAND5A, ZNF216

Gene Description :
zinc finger, AN1-type domain 5

Gene Summary :
O

Other Designations :
OTTHUMP00000021469|OTTHUMP00000021470|OTTHUMP00000021472|zinc finger protein 216|zinc finger, A20 domain containing 2

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PDGF-AA ProteinMedChemExpress
IL-17 Receptor site
Popular categories:
PDGF
ADAMTS20