Name :
Ntf4 (Mouse) Recombinant Protein
Biological Activity :
Mouse Ntf4 (Q80VU4, 80 a.a. – 209 a.a.) partial recombinant protein with an N-terminal Met expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
Q80VU4
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=4909
Amino Acid Sequence :
GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA
Molecular Weight :
~ 14.0
Storage and Stability :
Store at 4°C for 1 week. For long term storage store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized after extensive dialysis against 50 mM acetic acid. Reconstitute the lyophilized powder in 50 mM acetic acid or ddH2O up to 100 ug/mL.
Applications :
Functional Study， SDS-PAGE，
Gene Name :
NTF4
Gene Alias :
NT-4/5, NT4, NT5, NTF5
Gene Description :
neurotrophin 4
Gene Summary :
This gene is a member of a family of neurotrophic factors, neurotrophins, that control survival and differentiation of mammalian neurons. The expression of this gene is ubiquitous and less influenced by environmental signals. While knock-outs of other neurotrophins including nerve growth factor, brain-derived neurotrophic factor, and neurotrophin 3 prove lethal during early postnatal development, NTF5-deficient mice only show minor cellular deficits and develop normally to adulthood. [provided by RefSeq
Other Designations :
neurotrophic factor 4|neurotrophic factor 5|neurotrophin 5|neurotrophin 5 (neurotrophin 4/5)
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Neuropilin-1 Proteinsupplier
IL-7 Proteinsite
Popular categories:
Fc Receptor-like A
CD85f/LILRA5