Name :
S (Bovine coronavirus) Recombinant Protein
Biological Activity :
Bovine coronavirus S (P25194, 326 a.a. – 540 a.a.) partial recombinant protein with N-terminal His tag expressed in Escherichia coli.
Tag :
Protein Accession No. :
Protein Accession No.URL :
Amino Acid Sequence :
PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIEAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTAASCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPIT
Molecular Weight :
27.7
Storage and Stability :
Store at -20°C or lower, liquid antibodies are stable at least 6 months.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
In Tris-based buffer (50% glycerol).
Applications :
SDS-PAGE,
Gene Name :
Gene Alias :
Gene Description :
Gene Summary :
Other Designations :
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-10 Proteinmanufacturer
IL-4 ProteinBiological Activity
Popular categories:
CEA Cell Adhesion Molecule 8/NCA-95
GRO-gamma