NRG1 (Human) Recombinant Protein

Name :
NRG1 (Human) Recombinant Protein

Biological Activity :
Human NRG1 (Q02297-6) recombinant protein expressed in E.Coli.

Tag :

Protein Accession No. :
Q02297-6

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3084

Amino Acid Sequence :
MSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE

Molecular Weight :
7.6

Storage and Stability :
Stored at -20°C to-80°C for 12 month.After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :

Purification :

Quality Control Testing :
Reducing and Non-Reducing SDS PAGE

Storage Buffer :
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).

Applications :
Western Blot,

Gene Name :
NRG1

Gene Alias :
ARIA, GGF, GGF2, HGL, HRG, HRG1, HRGA, NDF, SMDF

Gene Description :
neuregulin 1

Gene Summary :
The protein encoded by this gene was originally identified as a 44-kD glycoprotein that interacts with the NEU/ERBB2 receptor tyrosine kinase to increase its phosphorylation on tyrosine residues. This protein is a signaling protein that mediates cell-cell interactions and plays critical roles in the growth and development of multiple organ systems. It is known that an extraordinary variety of different isoforms are produced from this gene through alternative promoter usage and splicing. These isoforms are tissue-specifically expressed and differ significantly in their structure, and thereby these isoforms are classified into types I, II, III, IV, V and VI. The gene dysregulation has been linked to diseases such as cancer, schizophrenia and bipolar disorder (BPD). [provided by RefSeq

Other Designations :
glial growth factor|heregulin, alpha (45kD, ERBB2 p185-activator)|neu differentiation factor|neuregulin 1 isoform HRG-gamma|sensory and motor neuron derived factor

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-33 medchemexpress
IL-5 ProteinBiological Activity
Popular categories:
Toll-like Receptor 9
Caspase-5

haoyuan2014