Il12a/Il12b (Mouse) Recombinant Protein

Name :
Il12a/Il12b (Mouse) Recombinant Protein

Biological Activity :
Mouse Il12a/Il12b (P43431/P43432) recombinant protein expressed in HEK 293 cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :
Result of activity analysis

Protein Accession No. :

Protein Accession No.URL :

Amino Acid Sequence :
p35: RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSAp40: MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Molecular Weight :
p35: 21.8, p40: 35.8

Storage and Stability :
Stored at -20°C to-80°C for 12 month.After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.Aliquot to avoid repeated freezing and thawing.

Host :
Human

Interspecies Antigen Sequence :

Preparation Method :

Purification :

Quality Control Testing :
Reducing and Non-Reducing SDS PAGE

Storage Buffer :
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5.

Applications :
Western Blot, Functional Study,

Gene Name :

Gene Alias :

Gene Description :

Gene Summary :

Other Designations :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Insulin Recombinant Proteins
GM-CSF Proteinsupplier
Popular categories:
C-Type Lectin Domain Family 10 Member A/CD301
CD11c

haoyuan2014