C10orf48 (Human) Recombinant Protein (Q01)

Name :
C10orf48 (Human) Recombinant Protein (Q01)

Biological Activity :
Human C10orf48 partial ORF ( NP_775847, 1 a.a. – 95 a.a.) recombinant protein with GST-tag at N-terminal.

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_775847

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=283078

Amino Acid Sequence :
MNTIVFNKLSSAVLFEDGGASERERGGRPYSGVLDSPHARPEVGIPDGPPLKDNLGLRHRRTGARQNGGKVRHKRQALQDMARPLKQWLYKHRDN

Molecular Weight :
36.19

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
MKX

Gene Alias :
C10orf48, IFRX, IRXL1, MGC39616

Gene Description :
mohawk homeobox

Gene Summary :
MKX is a member of an Iroquois (IRX) family-related class of ‘three-amino acid loop extension’ (TALE) atypical homeobox proteins characterized by 3 additional amino acids in the loop region between helix I and helix II of the homeodomain (Anderson et al., 2006 [PubMed 16408284]).[supplied by OMIM

Other Designations :
Iroquois family related homeodomain protein|OTTHUMP00000019374|iroquois homeobox protein-like 1

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CNTF ProteinBiological Activity
FGF-18 ProteinPurity & Documentation
Popular categories:
FES Proto-Oncogene, Tyrosine Kinase
SARS-CoV-2 N Protein C-terminal Domain