U2AF1L3 (Human) Recombinant Protein (Q01)

Name :
U2AF1L3 (Human) Recombinant Protein (Q01)

Biological Activity :
Human U2AF1L3 partial ORF ( NP_659424, 103 a.a. – 201 a.a.) recombinant protein with GST-tag at N-terminal.

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_659424

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=199746

Amino Acid Sequence :
GNVPEVASATSCICGPFPRTSRGSSMGGDPGAGHPRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKPPSLSCPILPRLPGSI

Molecular Weight :
36.63

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
U2AF1L4

Gene Alias :
FLJ35525, MGC33901, U2AF1-RS3, U2AF1L3, U2AF1L3V1, U2AF1RS3, U2af26

Gene Description :
U2 small nuclear RNA auxiliary factor 1-like 4

Gene Summary :

Other Designations :
U2 small nuclear RNA auxiliary factor 1-like 3|U2(RNU2) small nuclear RNA auxiliary factor 1-like 3

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
AGER Proteinsite
Leukemia Inhibitory Factor Recombinant Proteins
Popular categories:
Influenza Non-structural Protein 1
ICAM-2/CD102

haoyuan2014