Name :
DNCL2A (Human) Recombinant Protein (P01)
Biological Activity :
Human DNCL2A full-length ORF ( AAH02481, 22 a.a. – 96 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
AAH02481
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=83658
Amino Acid Sequence :
VVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
Molecular Weight :
33.99
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (96); Rat (96)
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，
Gene Name :
DYNLRB1
Gene Alias :
BITH, BLP, DNCL2A, DNLC2A, ROBLD1
Gene Description :
dynein, light chain, roadblock-type 1
Gene Summary :
This gene is a member of the roadblock dynein light chain family and encodes a cytoplasmic protein that is capable of binding intermediate chain proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression. [provided by RefSeq
Other Designations :
OTTHUMP00000030691|ROBL/LC7-like 1|Roadblock-1|bithoraxoid-like protein|cytoplasmic dynein light chain 2A|dynein, cytoplasmic, light polypeptide 2A|dynein-associated protein HKM23|dynein-associated protein Km23|roadblock domain containing 1
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Dkk-1 ProteinMedChemExpress
IL-5 Proteinsupplier
Popular categories:
Calcineurin B
Ubiquitin Conjugating Enzyme E2 G1