For research use only. We do not sell to patients.
PEAQX
CAS No. : 459836-30-7
Biological Activity:PEAQX(NVP-AAM 077) is a potent and orally active NMDA antagonist with a 15-fold preference for human NMDA receptors with the 1A/2A(IC50=270 nM), rather than 1A/2B(29,600 nM).
IC50 value: 270 nM(hNMDA A1/A2) [1]
Target: NR2A antagonist
in vitro: PEAQX has a high binding affinity for NMDA receptors (IC50=8 nM), and a functional preference in excess of 100-fold for hNMDA 1A/2A (IC50=of 270 nM) over 1A/2B receptors (IC50=29,600 nM) [1].
in vivo: PEAQX is practically inactive in Xenopus oocytes expressing hNMDA 1A/2B receptors, displays an ED50 value of 23 mg/kg in the MES test [1]. Sprague-Dawley rats were treated on PN7, PN9, and PN11 with PCP (10 mg/kg), PEAQX (NR2A-preferring antagonist; 10, 20, or 40 mg/kg), or ifenprodil (selective NR2B antagonist; 1, 5, or 10 mg/kg) and sacrificed for measurement of caspase-3 activity (an index of apoptosis) or allowed to age and tested for locomotor sensitization to PCP challenge on PN28-PN35. PCP or PEAQX on PN7, PN9, and PN11 markedly elevated caspase-3 activity in the cortex; ifenprodil showed no effect. Striatal apoptosis was evident only after subchronic treatment with a high dose of PEAQX (20 mg/kg). Animals treated with PCP or PEAQX on PN7, PN9, and PN11 showed a sensitized locomotor response to PCP challenge on PN28-PN35 [2].
Research Area:Neurological Disease
Targets:iGluR
Related Small Molecules:CIQ;Quinolinic acid-d3;1-Aminocyclobutanecarboxylic acid;Glycine-1-13C,15N;ZL006;PYD-106;NMDA-IN-2;JAMI1001A;(S)-Willardiine;Fanapanel;(S)-AMPA;L-Glutamic acid-15N,d5;PDZ1 Domain inhibitor peptide TFA;Ifenprodil tartrate;Rislenemdaz;Coluracetam;Flupirtine-d4 hydrochloride;DL-Phenylalanine-d5 hydrochloride;NMDA;CFM-2;Lanicemine dihydrochloride;L-Phenylalanine-13C9;VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA;L-Glutamic acid monosodium salt;Glycine-15N;Ibotenic acid;GYKI-47261 dihydrochloride;Sunifiram
Trending products:Recombinant Proteins | Bioactive Screening Libraries | Natural Products | Fluorescent Dye | PROTAC | Isotope-Labeled Compounds | Oligonucleotides
About Us:
- MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use;
- Structurally and synthetically diverse biologically active compounds;
- roduct quality is the key to our success and we take pride in offering only the highest-grade products.;
- We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.;
- Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.;
- Customized order volume ranging from milligrams to kilograms scale;
Structurally and synthetically diverse biologically active compounds;
We provide customer-oriented services. To explore more, please contact us at [email protected]. Our team will gladly assist you.



